Leptin Receptor/LEPR Antibody orb389491 from Biorbyt

Product Specs
ItemLeptin Receptor/LEPR Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb389491
Quantity10 µg, 100 µg
ApplicationsELISA, IHC
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetLeptin Receptor/LEPR
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSD), different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig
NCBI Full Gene Nameleptin receptor
NCBI Gene AliasesCD295, LEP-R, LEPRD, OB-R, OBR
ClonalityPolyclonal
Molecular Weight132494 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat ELISA, 0.1-0.5µg/ml, Human

Add to Compare List